DPCstruct | MC4935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E7II44 | 4-74 | PQSRQLELQDVELSADLRLPLHADGLVIFVHGSGSGRLSPRNRFVAQLLARRGLGSLLFDLLTEPEQRLDN |
| A0A059DQK0 | 1-74 | MMQTEDIRIGSKGLGGFLTVPDKARGLIIFAHGSGSSRHSPRNAYAARSFERLGFATLLFDLLTEHEAGDRRNV |
| A0A838U1H1 | 5-75 | None |
| A0A1H4QJ93 | 35-103 | None |
| A0A6I1R332 | 2-75 | None |
| A0A2V0P120 | 416-510 | None |
| A0A2H0DTQ0 | 1-66 | None |
| A0A514XFM2 | 217-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.