DPCstruct | MC49349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7MH03 | 1-98 | MVGELPREMTLEERVWWANPYLRMLSSPLRKCFETEQMLPRDFLLRLSAMRVKTPRLGKPAQALFPDGLEHPAFSGHKAGVGHYIIC… |
| A0A0M8MLN3 | 1-103 | MARNGNLSSRSVLEHAERQWPSNPYLHMLSTPLRRCIVSHFVLPKAFMIQIKPVHLPSSEEHPPEITMAPDGILHPRFAMRKPGIGA… |
| A0A0J0XWD4 | 59-168 | None |
| A0A1C7NPE1 | 1-120 | None |
| A0A317SM02 | 88-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.