DPCstruct | MC49339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 206 ± 26 aa |
| Standard deviation of domain lengths | 25.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8TEJ4 | 9-202 | PCLLLSLFTSLNLCSGKFGTPITDDVSKLSLLKQNIPSDYEIPVSYIPKEVAGTCWVVLNIYPLEQSLRKLANMFGTISSNKENIVV… |
| A0A3B4TST3 | 1-157 | TQDHLLSLNRLIDNQLDRSCFIIYPFTDHHNLSQVCYIKAAFPQILKLLGTHFHYVRNSDNRRYVSSWEKVIYHLYSQGCVPAINEE… |
| A0A674JVL3 | 36-253 | None |
| A0A7J7RC52 | 50-277 | None |
| A0A091DTX1 | 10-211 | None |
| A0A2K5Z9R2 | 3-214 | None |
| A0A3Q4M740 | 2-179 | None |
| A0A5F8ADB4 | 179-421 | None |
| F6T7S9 | 139-373 | None |
| A0A1B0GS68 | 15-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.