DPCstruct | MC49332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7VMX4 | 3-112 | RLGEFVKAAERYDITLLHAEDDTDIPMEHSIKLYREAVQAAEGVKDSAENDGELLSRISSVEKGRGAGGSITVWPTSKGNIRLEILK… |
| A0A423WHS4 | 882-993 | KDRIAELVRTSDRYHITLLHAEDDSAIPAEHTESLYWHAVSATSENNLSFGEFEEEKEKRKTRLGEGGWSVEWHTEKGLIRQDMPKY… |
| A0A366RIX9 | 257-383 | None |
| F0XF59 | 243-375 | None |
| A0A178AU73 | 260-389 | None |
| H0EI24 | 76-215 | None |
| A0A0D9NIV5 | 415-545 | None |
| A0A6G1NFJ9 | 6-138 | None |
| A0A395M8X0 | 61-191 | None |
| A0A366P6V5 | 20-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.