DPCstruct | MC49331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1DBQ8 | 16-190 | YKKGISKERAAENESKTEKTAAEQKEQYIPNSSVEQKTTYEKPKADQATIDKLKGESDRIYNDLRKIVEELLKKQGMTFSDVTADTI… |
| A0A645J2V2 | 2-145 | EIGNKPLSSVIYSKSAAKKADITDIEALKRQADRATENLRNLVQKLLVEQGNKAHKKALLYNEAVAQANEALSENGDFGVEAVSDRI… |
| A0A1M4XHY4 | 22-218 | None |
| A0A840RKH5 | 1-224 | None |
| A0A1E7IJG4 | 1-181 | None |
| A0A366MKW6 | 25-196 | None |
| A0A1F9Y456 | 117-265 | None |
| A0A7G1G960 | 2-175 | None |
| A0A1I0YBC2 | 22-222 | None |
| A0A354CUI0 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.