DPCstruct | MC4933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5IEC4 | 7-116 | RTLISATLALAATGLTLIATAGPVSAASIAPSINVRTGDLNLASPAGQATLHNRLRQAARSLCDVNGPAPVAQRQAAARCARETLAG… |
| A0A418WNT3 | 1-107 | MKTMLALTALAGALYVAPATAQSPADGTNTRVVRYADLDLGTEKGRDALDRRIRVAVSAACGTASSVDPEGKREVRRCKADTLAHVA… |
| A0A5B9YSC9 | 89-202 | None |
| A0A3D6A1I8 | 65-187 | None |
| A0A514WEP7 | 12-149 | None |
| A0A654ABE9 | 1-131 | None |
| A0A3R9WMH0 | 61-202 | None |
| A0A494VWP8 | 1-116 | None |
| A0A4R3TFX6 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.