DPCstruct | MC49322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 340 ± 80 aa |
| Standard deviation of domain lengths | 79.80 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 99.06 |
| Assigned Pfam label(s) | PF20237- CL0380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TL35 | 174-499 | SCLKRAELKLPPAFSAWEDIAKDLSALTSSGKLRGIIDNRIPNGLAKPWIKVSEAIDILPIINYAAAVLFNFRPVNPTEPLSLDGSI… |
| A0A388P2U5 | 26-331 | TSLSAANGAWDEMARNLPKYLMGSDFRSRVKSLPPFKMDALASEGEVRRAMLALSYIGMAYQWSENEAAHVIPAVLAKPWYELGVKV… |
| A0A2D3V0S7 | 1-306 | None |
| A0A4Z0YEV4 | 344-712 | None |
| A0A6A5UKJ1 | 26-304 | None |
| A0A7S2JWF4 | 200-594 | None |
| G4T9Q4 | 282-651 | None |
| A0A1G9TZW5 | 42-245 | None |
| A0A179HE29 | 748-1146 | None |
| A0A498LSR6 | 464-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.