DPCstruct | MC49321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 280 ± 27 aa |
| Standard deviation of domain lengths | 27.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TKC9 | 1-331 | MITATSCTLAMALLWTGRMPRICFLLWFLVWRLAYNVGLGFVLRWQSEDEWFTDLMRRLFRMKHPLMEQWAKPAIRVKMDRDYSFHS… |
| A0A7Y5KRK5 | 15-272 | SVATCVLASSGLRIDNLSRYTLVTLALGAVGYGAHHAIVADVAESGRIWLVYAYFAALFVTRYVYLFTSFGRGGIADTLIHWFGEER… |
| R7QMW6 | 26-297 | None |
| A0A7J7ISE1 | 1-259 | None |
| R8BEE4 | 2-321 | None |
| A0A165INF1 | 165-438 | None |
| A0A367YCT2 | 3-261 | None |
| A0A5E3WRU0 | 76-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.