DPCstruct | MC49319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 189 ± 26 aa |
| Standard deviation of domain lengths | 26.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TK15 | 1-189 | MQALPTRTHAAFQWALKFNKECSKGRLEQLQALERQLGMKTPDADSEKGRLVYRSWRHCLSGAIRINTALERRIRVGRLAFSLPESR… |
| A0A507ATZ7 | 547-752 | RRAAVRTSQNIPFEQMPYQCFQEARKLLREDRDAKVRQIVAETDRIRKLEAADPAQFRGGEAYRQKRLASLRRYVDQLKILADINDP… |
| A0A166T9V4 | 63-272 | None |
| A0A6L5CQE8 | 44-206 | None |
| L0PBB6 | 46-226 | None |
| A0A1Q3E6G0 | 5-201 | None |
| A0A093VFC2 | 90-288 | None |
| A0A0C9W9R8 | 20-223 | None |
| A0A1Y1USF1 | 1-211 | None |
| A0A7D9MBD1 | 53-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.