DPCstruct | MC49317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 371 ± 90 aa |
| Standard deviation of domain lengths | 90.00 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 86.79 |
| Assigned Pfam label(s) | CL0286- CL0279- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5LK68 | 78-340 | EPIIGIETHVQLSTLTKAFCSCPYNYGSHPNTTICPICMGLPGALPVLNSKVIDFAVKLGLALNCKLAFNSKFDRKQYFYPDLPKGY… |
| A0A2H9TIM1 | 7-410 | WTTVVGLEIHAQLASRHKLFSVAPNNCDAQLGTCCAPFDAAVPGALPLLNQECVDLALRAAIALRCNIRSRSFFDRKHYRYDDLPLG… |
| A0A0K9QJH8 | 70-288 | None |
| A0A832ZXA5 | 5-421 | None |
| A0A4Y7L8Y3 | 71-458 | None |
| A0A2C9JR38 | 384-833 | None |
| A0A0G0V2N4 | 2-402 | None |
| A0A3T0Y475 | 498-962 | None |
| L9JJ92 | 70-402 | None |
| A0A536RDR0 | 294-699 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.