DPCstruct | MC49303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 205 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5E7J4 | 305-505 | GSVVPPSTAGVLSLGSGDIDIFSLNSVLLGQSRVFTTFGGDLFIWSVRGDINAGRGSKSTAVYQPPRRVYDVYGNVTLSPPTQNTGA… |
| A0A7Y8B8R0 | 79-241 | DITLFGGSGVHTNFGGSIQMLTPGGGQTFGIEGAAPPSTAGVITQGAGDIQLYSMGSILLGQSRIMTTFGGSIMGWSGEGDINAGRG… |
| A0A556UPV6 | 667-894 | None |
| A0A7Y8HBW0 | 139-324 | None |
| A0A5B7QXE8 | 684-883 | None |
| A0A4P5RBE4 | 1-215 | None |
| A0A1H4UFT6 | 851-1058 | None |
| A0A849UCH5 | 795-993 | None |
| A0A844YIL0 | 483-686 | None |
| A0A1M3D5L9 | 264-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.