DPCstruct | MC4930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 203 ± 24 aa |
| Standard deviation of domain lengths | 24.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0BM34 | 116-301 | SDPTTPTSSAGCADGSICFTSPLAFTTVEGVLGSILSTLQGIIVLISIVFIVIGAVMYIISSGNDDMIKKAKNAITAAMIGLAIGIA… |
| A0A5P8NEZ9 | 97-301 | SKSKRQIMYSTIGLIFINIPGTLYNAINNDTASTIGGRVGVSSFIKKPGNSDSNVFIDIFDFGNTINGDIIGFLEVFISAAAIGMIL… |
| A0A7T9IZB4 | 95-282 | None |
| A0A1G1WUS0 | 14-207 | None |
| A0A7T9K1P6 | 230-408 | None |
| A0A1F6Y091 | 62-255 | None |
| A0A7T9QDD7 | 20-205 | None |
| A0A7V5LD11 | 33-242 | None |
| A0A1F7BN12 | 37-299 | None |
| A0A1F6WZP4 | 2-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.