DPCstruct | MC493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 23.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0028- PF04148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9T5L0 | 4-151 | YAGAYLFVLFFAVCLATGLYYLAELVEEYTRLTRKVISYVIKFVIALHVILLVVDRLPMISIGVGIASHVVYHRLLKTFPYISLTAP… |
| A0A286UNT2 | 491-695 | MSLLYLLSYVGFLVAAGFVILSLASGLLWISELIEEHSKLAKIVGIRAIYVIIATHIILYFTDGLPFLQTIFSIGCHLVYLQNFSST… |
| A8J0W3 | 5-187 | None |
| A0A2J8AI44 | 4-167 | None |
| A0A2W1BJ92 | 1-125 | None |
| A0A452V886 | 17-158 | None |
| R7TXL5 | 3-134 | None |
| C1DYN2 | 3-198 | None |
| E3S9B7 | 5-199 | None |
| A0A5A9PPY6 | 25-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.