DPCstruct | MC49293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5QRC9 | 115-173 | GTVFHIFLGEKIKDIQAVKKLIQKIFTNFHLPYITLTPTFSICPVHGYLEGEHFYCPKC |
| G2DF28 | 2-61 | LHLYMNERISSTEACRRLVRRSLERFRLPYITITPTFSICPTHGYLSGEHEFCPKCDEEA |
| A0A7V5XH09 | 20-76 | None |
| A0A7C5UN91 | 575-631 | None |
| A0A7C1CC81 | 1-53 | None |
| A0A661S8W2 | 111-169 | None |
| A0A0S4VU04 | 1-62 | None |
| A0A1Y5Q642 | 876-938 | None |
| A0A7C2UK88 | 274-343 | None |
| A0A7C3X212 | 214-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.