DPCstruct | MC4929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8M982 | 1-80 | MSSNAEQILKTQIIEKAWSDPVFKKQLLEDPKAAIHAAFGVEIPENIKLTVVEETANSFYLVIPPSPQVDKARASQTTQG |
| A0A348AHU5 | 1-89 | MSQENQNALFEKIVKKAWENDNFKKSLIADPKAAIEAEFGVKVPAGIELKVVEQTAKLRYIVMPEKAGTLSEEQLDNVAGGGCTGYF… |
| A0A6L7ULA7 | 5-98 | None |
| A0A7V6X0V7 | 1-67 | None |
| A0A6J4JAY1 | 35-138 | None |
| A0A1H8Y6K3 | 24-126 | None |
| A0A6L8DYE6 | 128-230 | None |
| I3TKS0 | 1-104 | None |
| A0A2K8VGW6 | 1-103 | None |
| A0A1G9KTR4 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.