DPCstruct | MC49289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 158 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 84.98 |
| Assigned Pfam label(s) | PF03726- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8ZQE6 | 2-157 | SAKVEADAKESLLQAIQVKEKHAREEAIKQVKDSILEGYDEDEPEIYNQVKTILDKLVKAEVRRLITVEKVRPDGRMIDEIRPLSSR… |
| A0A4U9TRS6 | 129-235 | NEALHARVTELAESRLGDAYHITEKQERYAQVDAIKDSVVETLLAQDETLDASEIQDILGTVEKNVVRSRVLRGEPRIDGREKDMIR… |
| A0A388QNI6 | 58-204 | None |
| A0A1Q7C8B0 | 217-377 | None |
| T0CLN1 | 51-213 | None |
| A0A843U7B0 | 264-421 | None |
| A0A7E4SGL6 | 537-694 | None |
| E2BQX3 | 127-293 | None |
| X8F8R8 | 73-227 | None |
| A0A0K2V1H4 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.