DPCstruct | MC49286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 185 ± 38 aa |
| Standard deviation of domain lengths | 37.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5V2A8 | 2-133 | VVIETPQFSNSRRIIVIANNITFKIGTFGLASDNFFDQVTELSRKLGMLRMYLSANSVSWLGIADEVTDQFWTAWSKPENPNKGFKF… |
| A0A0V0XVB8 | 73-259 | TLKTPEYVNGRDIIVIANDMTHLIGSFGVEEDQLFYKASQLSRQLKIPRIYVAANSGARIGLSDEVRNAFRIAWEDADDPEKGFKYL… |
| A0A1D2NFA1 | 357-510 | None |
| A0A7R9PVD6 | 45-259 | None |
| A0A5N4D652 | 1-186 | None |
| A0A821UC68 | 521-737 | None |
| A0A7R9A190 | 597-713 | None |
| A0A7S3GGZ4 | 2-172 | None |
| A0A183MQ30 | 11-232 | None |
| A0A4P9Y308 | 101-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.