DPCstruct | MC49285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 21.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5UYM6 | 2-140 | SLRVETMFGPSKRFSVRTYLVPGMCVFLSLTAAFNHSQNQLQLQSTCDPLPFTQETWKNRKIDKYISEYPGGHNLTVNEYAAKVGAK… |
| F4RK72 | 1-100 | MTLQDPCAKLPLTPDLWEQLGLDEYLRTYPSGNNLTLEEYAEKVGATNFVCGIGKTCNANQICMPVRAPDWYILVAVQNWNQFSNMM… |
| A0A2N5UZ10 | 1-152 | None |
| F4RDU7 | 1-99 | None |
| A0A0L6VGI7 | 4-142 | None |
| F4SEF3 | 1-122 | None |
| A0A2S4W119 | 2-128 | None |
| A0A180H1S2 | 24-174 | None |
| A0A0L0UYA4 | 34-173 | None |
| A0A2N5S1H4 | 7-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.