DPCstruct | MC49280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4PEP4 | 10-146 | NTLKNGNRDQINLILPHHFLFLLSLHLKLATPFSNIKLTDLFGYETPLEQTNNTSSVIFSFTTPKPLFTLNVITLNNPLFPIKMNMP… |
| A0A0D8DMG5 | 6-127 | ADEKDKGGMRVITLDKKDLIEAMTEFKSQGYYLSSITGVDMKDHLEVIYHLHNFDKNEYLGVKVLTYDSKVPSLVGLWKAADWDERE… |
| A0A832EEV0 | 3-106 | None |
| C7N625 | 7-137 | None |
| A0A662U2D5 | 21-160 | None |
| A0A2V2E687 | 2-116 | None |
| A0A357ZF65 | 4-116 | None |
| A0A847SYJ1 | 5-108 | None |
| A0A6G3VCZ9 | 2-81 | None |
| A0A482VTS0 | 276-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.