DPCstruct | MC49279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 19.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 56.49 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0105- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PVQ2 | 29-149 | SHRKFSAPRHGSKGFLPKKRSKRHRGKVKAFPKDDPSKPVHLTAFLGYKAGMTHVVREVDRPGSKVNKKEVVEAVTIIETPPMVCVG… |
| H0XV01 | 1-120 | VFHRKFSAPRHECLSFLPQKCTSRHYGKVKSFPKDDLSRIHFKAFLGYKAGMTYIMWKVNRPGFKVNKKKVVEAITIVDILPRVDVG… |
| A0A212CLV5 | 36-150 | None |
| A0A284QYX5 | 496-640 | None |
| A0A146I0Z6 | 798-951 | None |
| A0A6A6L103 | 112-205 | None |
| A0A1I8I8V1 | 598-718 | None |
| A0A0D9XPH0 | 292-413 | None |
| A0A438MY39 | 737-887 | None |
| A0A6P8SYI8 | 56-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.