DPCstruct | MC49278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 96.80 |
| Assigned Pfam label(s) | PF04776- PF12066- CL0320- CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0XPZ6 | 15-137 | LAVALAVSSAARLVGGWMDAQVNEEGVQRALDFAISEYNKASNDRYQSRALQVKNARKQVVAGMNYALEVEIGRTTCTKSQPKLGDC… |
| A0A838MZV2 | 2-74 | TAAFAAREESRRTGTPIRVVKVLKSETQVVAGTNFRLRIAAQRNGASTETAEALVFRDLGGKRHLTSWRWIKD |
| M1A5K0 | 136-231 | None |
| C5WVX1 | 70-177 | None |
| A0A6I8P042 | 22-150 | None |
| W5LXR4 | 134-255 | None |
| A0A843X9P7 | 544-646 | None |
| A0A0K0E2Y2 | 4-131 | None |
| A0A3Q0JF48 | 1-117 | None |
| A0A2I0I4B8 | 7-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.