DPCstruct | MC49277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Standard deviation of domain lengths | 16.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U3CF85 | 1-57 | MVAVDVQSRREGRDLRKVGFYDPISNQTYLNVPAILYFLERGAQPTGTVHDILKKAG |
| A0A5Q4F8S9 | 1-88 | MIKLRLQRKGRKKRPFYHIVVADSRSPRDGRVIERLGRFDNVSEQKELTLDAERVMHWLKIGAQPSDTVRSILKSEGILYRMHLVRWG |
| A0A1W5WL90 | 2-60 | None |
| A0A2N9IS26 | 2-91 | None |
| A0A3D1R7K4 | 42-125 | None |
| A0A6J4N3A1 | 1-94 | None |
| A0A1W9X5F9 | 2-59 | None |
| A0A212CN97 | 119-203 | None |
| A0A7X1PC72 | 2-97 | None |
| A0A510JFW1 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.