DPCstruct | MC4927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518CBD1 | 2-101 | FIAKVTGSVISTQKVDTMVGHKLLVVEPYRLEAKDRQSLVTTGRTFVAVDMLGSGVGDFVLITQGSSARLTPETKSLPIDCVVIGIV… |
| A0A1C5KVR3 | 218-303 | EQAMILGIVKGTVVATRKMPELVGYKFLLVEPVFGSKKDTIVAGDNIGAGVGEMVLVTTDETTQHGLDHPSPIDAFIVGIVDNPPT |
| Q8Z4T7 | 136-221 | None |
| A0A7V0T9A0 | 1-76 | None |
| A0A1Y3R494 | 1-75 | None |
| A0A523V8F5 | 16-103 | None |
| A0A6G3HLL7 | 1-77 | None |
| D3SFZ8 | 1-87 | None |
| A0A7X9AEX0 | 1-102 | None |
| A0A2E0KHJ9 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.