DPCstruct | MC49266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7JKK3 | 2-131 | GSGVVKVCLASGVSVHVSVVVASSKPLNFAFILGMNGITALHGVRVCSQTDVVFGLEEEQGLAVAAANSPDIDERDFKVTFDTETKQ… |
| A0A085MRB6 | 2-114 | VEAIIVRKRLLNFDFIIGMRGITALRGVAVDGEGQVQFGTGNPTLCASAEARIHIEKKDFFATYDPVTHVWTVAWKWSNGLAPGQLG… |
| A0A0B1PKE9 | 4-124 | None |
| A0A6A4W378 | 199-321 | None |
| A0A5S6QS42 | 6-142 | None |
| A0A5S6QHX4 | 1-128 | None |
| A0A5S6Q0P9 | 158-294 | None |
| A0A0B1PEA3 | 1-95 | None |
| A0A085MZB4 | 48-176 | None |
| A0A0V1LHR4 | 5-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.