DPCstruct | MC49262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7JE84 | 9-92 | FAMPYDNPIPGYKNNVVNTMRLWSAKSTNNFDLKFFNDGDYIQAVLDRNFAENISRVLYPNDNFFEGKELRLKQEYFMVAATLQ |
| A0A453LTZ1 | 138-221 | AVAHDVPIPGYKTKTTNNLRLWSTTVPSQNFDLGAFNAGDHAKANEAHLNAEKICHVLYPGDESSEGKILRLKQQYTLCSASLQ |
| A0A811NV31 | 39-137 | None |
| A0A2X3BR42 | 1-81 | None |
| A0A377YYR9 | 1-81 | None |
| A0A6A3CGM1 | 110-203 | None |
| A0A6A0AFW9 | 45-136 | None |
| A0A6A4V0U7 | 148-230 | None |
| A0A643C449 | 548-630 | None |
| A0A2P4SCN2 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.