DPCstruct | MC4926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554JNR7 | 18-119 | NIEKLNDFQREAISHFTNVEKRLNRSVQAVETLRFNPFKGTGDGGNQSFSTAFISQNGDGVIISSLYSRDRISIFSKPVEKFQSTFE… |
| A0A068NRZ1 | 5-94 | LAELEGRSTRLENALAVSKRHLGLVRYDAFDDVGGNQSFTMAVYDDAGNGAVLTSIIGRTDCRVYCKPLVNGRSERDLSQEEQRAIR… |
| A0A3A0BHK2 | 40-152 | None |
| A0A1G6M5Q7 | 46-158 | None |
| A0A212TF51 | 375-487 | None |
| A0A2H0YB02 | 54-154 | None |
| A0A6L5FZQ3 | 27-127 | None |
| R5ZJE7 | 14-116 | None |
| A0A3M1D9U9 | 69-197 | None |
| A0A543IPD9 | 20-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.