DPCstruct | MC4925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HU73 | 27-113 | ITGLDIVGALSRSGFEDIASNILNMLRQRVTGDYLQTSAILDRQFEVVSAVNDINDYQGPGTGYRISAERWAEIKNIPGVVQPDTIE |
| A0A847WJ46 | 1-78 | VQGGYDDVADSVLQMLKQRITGDYLHTSSILTEDFEVISAINDANDYQGPGTGYRLSKERWEEIKNIPHIIERKEFSS |
| A0A7H4NXM8 | 103-188 | None |
| A0A0U1D1C7 | 160-243 | None |
| A0A378W5M0 | 164-247 | None |
| A0A378FYS2 | 13-85 | None |
| A0A6J6TPU3 | 79-160 | None |
| A0A6J7TT74 | 316-397 | None |
| A0A379SSY0 | 44-129 | None |
| A0A645CJG5 | 201-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.