DPCstruct | MC49246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 140 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834MYA5 | 28-165 | LLKLKAPTWTRHDLQEAIEAVVTQKMRFTQASTKYGIPKGTLYDNILGKSKRMMVLEEAGLNSNEETAVLEFCCDISISPYNRRTKK… |
| A0A6P7F049 | 1-119 | MRFTQASSRYGIPKGTLYDNILGKSKRMAVLEEAGLTHTEEMAVLEFCCDVSVSPYNRRTKKSLKSVLDFVQRLRRMRDPEFMFTGL… |
| Q17KB7 | 17-158 | None |
| A0A6V7I926 | 1-144 | None |
| A0A182H183 | 74-218 | None |
| A0A6R5I6Y6 | 565-705 | None |
| A0A195BHA6 | 81-222 | None |
| A0A7R9FV94 | 132-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.