DPCstruct | MC49237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7IGV6 | 2-109 | QLFYLVTLFPLAALATLNGHCSGSAATGVWKDNGICIKTSTCDQYHGEYKSGACPNDPNDVKCCVIGYAPNAETNPCGKYSVCDWTA… |
| A0A2J6S8T4 | 67-142 | TCKTPLGSGFCDDTSNACTGGAYVPNYCPGATNIQCCVASCNTGSATGNCLWTGSTCANSFVPNYCPGPNDVECCL |
| A0A1Y1V6Z2 | 25-123 | None |
| A0A1Y1VE89 | 1-123 | None |
| A0A1Y1UVQ8 | 2-106 | None |
| A0A3N4I4F7 | 11-123 | None |
| A0A1Y1X0C9 | 7-98 | None |
| A0A1Y1I0R2 | 2-105 | None |
| A0A447BR95 | 1-108 | None |
| A0A1Y1X4L9 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.