DPCstruct | MC4923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 7 aa |
| Standard deviation of domain lengths | 6.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847WEF0 | 1-138 | NSLCVLTTRLPNTREEDRFIFGVFLVDENYEGDNYEEGYVSTKSKYKIKLSPKEAEEMLFWSYHANENQPEVARWSSGLHRYFNDEQ… |
| A0A1V6A7C6 | 89-211 | TPRKINNADVGDIAFLTTRYPGDGEAGRFIFAAFRIAEVVPYDPEKSGWVKADDSLKLALSPDELVFFWDHYENRSNPSYIGWGSGR… |
| A0A3D4T8F3 | 102-219 | None |
| A0A847Z3H2 | 114-231 | None |
| A0A1G7UD77 | 1-131 | None |
| A0A7X6WFL6 | 128-261 | None |
| A0A847D4E4 | 42-164 | None |
| A0A1M6WCJ7 | 206-325 | None |
| A0A356M792 | 67-187 | None |
| A0A3D5VIY4 | 79-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.