DPCstruct | MC49225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 134 ± 30 aa |
| Standard deviation of domain lengths | 29.85 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2LTC2 | 5-137 | TGVICQIEKQVKRQLQWAACLLHFNELTFRHLFINLDGETTVPKSVSGPIGTQLSKCEKLPGVNFKSNECEISEIERKILSKDQQYL… |
| A0A6A4VIV0 | 100-241 | LSQDPPRPVHWFVCQLHANELLLRAAFHFLDGSTTGPKSFSGPLGRAASGEVHQLGVATFRAVPGPLPDLPDQLVAELSSDQQLLYR… |
| A0A4Y2CQK4 | 3-114 | None |
| T1FHT6 | 68-198 | None |
| T1FBS3 | 5-177 | None |
| A0A4Y2TJH5 | 19-147 | None |
| A0A4Y2SYE2 | 17-157 | None |
| A0A4Y2A4G7 | 5-112 | None |
| A0A4Y2A0T2 | 11-141 | None |
| A0A2G3APT4 | 12-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.