DPCstruct | MC4922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 183 ± 28 aa |
| Standard deviation of domain lengths | 27.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4ITG5 | 2-161 | IWVLIVLLAILLFPIRLKFTTVYENRMFRVYFFNKELNAKKKVMEEKANVRNYNIAHRKFYKIFKENFSTAIEKLSRNPHKIKAAVK… |
| A0A7X8PXE9 | 2-171 | RIQIHYEKQDEVQYLTLSLYLFRYIRIYKFNLVKYLRKKIEEYLEENHNNSFSTKSYINYKKSAKIIWNRIEKLKKHIYINFFDMNM… |
| A0A1G4VVX5 | 5-208 | None |
| A0A4D7JLC9 | 16-196 | None |
| R7AIM7 | 1-127 | None |
| A0A1H3KAY2 | 10-165 | None |
| A0A3S0CCA0 | 7-177 | None |
| Q67NF8 | 29-220 | None |
| A0A8B6T486 | 6-190 | None |
| A0A1G5UUU8 | 3-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.