DPCstruct | MC49219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 145 ± 33 aa |
| Standard deviation of domain lengths | 33.47 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2P924 | 150-291 | NAKRELIEFAPKKSTNDLDYIKESNGKLKYLFNIDLNTPIFPINNKNESIYFELHNEEYYPTDEKNKQYYAKDLNNFEKLAKSKGKE… |
| A0A4Y2LEV9 | 5-177 | QYPRRRNGSEYYSRGRKPFVVDPGGKERYAQDKIGNEMYPKRKLKQFARDKYFQEYYARDSKNNEFYPIKKRYSVVIQTKDGYKLAK… |
| A0A4Y2GQX7 | 3-118 | None |
| A0A4Y2PC12 | 304-426 | None |
| A0A4Y2PBD2 | 111-236 | None |
| A0A4Y2X806 | 126-244 | None |
| A0A4Y2X2M6 | 2-99 | None |
| A0A4Y2MTI9 | 1-117 | None |
| A0A4Y2PWF5 | 2-128 | None |
| A0A4Y2LZ08 | 27-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.