DPCstruct | MC49215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 235 ± 52 aa |
| Standard deviation of domain lengths | 51.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 75.02 |
| Assigned Pfam label(s) | CL0374- PF17297- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803KSS4 | 8-217 | LQSALAARGVIVEDKFFLNLNTFELKQKGATITESLSGLPIHVRGTVTGECSEISKAQFSKLLKQACVASHLSSISNIFIHDGAVGS… |
| A0A6R3G414 | 45-369 | ICDGSEEENQQLLSHMEEEGVIKRLKKYDNCWLALTDPRDVARIESKTVIITQEQRDAVPIPRSGLSQLGRWMSPEDFEKAFNARFP… |
| A0A2H9TMR3 | 664-935 | None |
| A0A835RUB6 | 304-496 | None |
| A0A1F9VCU1 | 14-223 | None |
| A0A1D6FBT5 | 130-294 | None |
| A0A1D6FBU2 | 1-190 | None |
| A0A1D6FBT4 | 210-380 | None |
| A0A446MP93 | 239-437 | None |
| L0AXR5 | 84-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.