DPCstruct | MC49213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 158 ± 26 aa |
| Standard deviation of domain lengths | 26.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 63.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6MVD9 | 1-134 | MSCRPFGELELDEVKGFMDLGFQFKKEYISPRMISVVPGLQRFCLLQNDKQYQSESQSQLMDDGSTENDDDIVEVYEDEEEKRDIMR… |
| A0A7I8IG83 | 2-117 | RRYKSFSELEEEEVKGFVDLGFVFNKETISPRMMRVVLGCRDWRGRRRRGGGAGRGGDEGEDEEAVPGGGVGCQRAQQPPFSIAESA… |
| A0A151TL50 | 28-201 | None |
| A0A1R3HT66 | 1-152 | None |
| A0A834H3G1 | 61-244 | None |
| A0A251TBW2 | 61-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.