DPCstruct | MC4921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 329 ± 76 aa |
| Standard deviation of domain lengths | 76.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511QZR7 | 112-348 | RPGADEAGQVLLLRALNPGVRVRVLYDNPQAAPQVTRYDGIPLQESVARLLASAGAVLVDSRPDLVLMVYTGGDPRRGVLTVLRGLR… |
| A0A7X8LBD4 | 63-395 | TDYLDRRKVNEQVNEVAIDLVKEGIIDFLIIPLDDCNPYGFSAITQRKLASFVRKYQLWDQVYIHPGADEIGCTLMARAINEWKQQQ… |
| R6W364 | 100-441 | None |
| A0A5C4T3S8 | 23-326 | None |
| A0A511N6U3 | 149-426 | None |
| A0A7X8U979 | 199-609 | None |
| A0A551YRH2 | 196-527 | None |
| R6P5P9 | 174-612 | None |
| A0A1W1V4F6 | 99-537 | None |
| A0A6P0MKV4 | 192-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.