DPCstruct | MC49207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183X9H2 | 1-83 | MSNVALTAISIAIGVFFIFFGTLKLGPLFSDELYRSVRKSFIRMFKTFPFSSLTGWNPSPHAIRRVYGTTEVVGGVVLASCPG |
| A0A1J1J460 | 1-83 | MTSIVLKSLSILLGCFFIFMGFMKISPYVSKELHRDLRKHYVKYAKVFPMASLFDLRVPSKWYRRAIGGIEIICGGLLAGFPN |
| A0A818JKK1 | 1-95 | None |
| A0A448X493 | 8-102 | None |
| T1JC91 | 1-95 | None |
| A0A821KFV4 | 1-83 | None |
| A0A4S2KJQ4 | 879-961 | None |
| A0A818FU53 | 1-95 | None |
| A0A814GH84 | 584-678 | None |
| A0A1I8IJ91 | 748-830 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.