DPCstruct | MC49204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 111 ± 20 aa |
| Standard deviation of domain lengths | 20.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | CL0422- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673XVE6 | 1-88 | MYLSDKPNYPLIQTLLDSLHQDLRLLVDPPDGSKEHPATTCLELWLCHPDYTSGMYYIDPNQGSPADALLAYCNFSGTAAHTCLHPRD |
| A0A183X8B3 | 13-114 | ITPNTLPSVGAVLRRIYARIESLEASMNSFEQPMGTQQNPARHCRDIYEAAEFPETLKSGVYWIDPNLGSPTDAFAVECRFQNTGDV… |
| A0A4W5L5W6 | 34-148 | None |
| C7DZK3 | 1561-1665 | None |
| A0A7D9D4X8 | 826-934 | None |
| A0A6L5D5R6 | 49-149 | None |
| A0A665U7G9 | 739-843 | None |
| A0A3Q0KS63 | 1214-1373 | None |
| A0A7M5WQ17 | 310-409 | None |
| A0A1I8IBI6 | 314-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.