DPCstruct | MC49203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183X7R7 | 1-66 | MLRSFENIGDHRGVFVCGGNPMWLFATDSGQIRVFPHSIDGLMGSFAPLNASICHSGFVYFTFSVS |
| A0A402G9A6 | 41-106 | GRVARFRYFEDIYGYSGVFICGPSPHWLLVTSRGALRLHPMTIDGPIESFAPFHNVNCPKGFLYFN |
| A0A183K8V0 | 455-529 | None |
| A0A5K3EWT7 | 851-925 | None |
| A0A3P8FP79 | 88-162 | None |
| G4VC18 | 1228-1301 | None |
| A0A482XI58 | 88-147 | None |
| A0A7R8W054 | 65-139 | None |
| A0A6I9NP77 | 61-130 | None |
| A0A5B7D564 | 119-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.