DPCstruct | MC49202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183X7E6 | 1-115 | MFTPLCDSKRILSSAWIISQKLHTGSVVCKNSRVGVVRRTRDCSIPQTYEQTKKPHQIGLMKSWNSWNTSNLDGEKRYTAEVTLHDQ… |
| A0A818LSB2 | 17-97 | RCYLSTINTEAAIPRHTRKRNYPLTYEQRQFPKLIGHTKTWNTFNTSNLRDGKYKAETVSDDLFLRQFIYGTWHSLFASEL |
| A0A0B2VNK5 | 110-191 | None |
| A0A5B7JN61 | 1-92 | None |
| A0A3Q3A5U5 | 73-165 | None |
| A0A4S2L0W8 | 202-297 | None |
| A0A811X6B0 | 586-688 | None |
| A0A834JVU3 | 112-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.