DPCstruct | MC49201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0023- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8KDQ9 | 12-124 | QIWKKLTGQKATANHAVELLAKRFCTQGSSQETTVLLVDELDLLWTQKQDIMYNLFDWPTHKDARLVVLTIANTMDLPERIMMNRVS… |
| A0A3P7QSE2 | 4-122 | IDPRKIFVDIYKQITENSNRISPAAARRRLNTMFEMADKNRPPIIILIDELDQLCTKKQELIYDIFNWTSVESARVSVMAIANTLDL… |
| A0A448XDY7 | 19-141 | None |
| X6NRB9 | 1-122 | None |
| A0A5S6Q4A7 | 3-129 | None |
| H1VV26 | 399-511 | None |
| A0A2P4VGY4 | 54-171 | None |
| A0A196SFH6 | 380-499 | None |
| A0A7S2R0Q2 | 12-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.