DPCstruct | MC4920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9GYS9 | 7-127 | RINPIVSFFMVVVALTYDGLKAFIELITFGFLGWAINPFINIWAQMTFLFWFTYLGVSFLKPGKMLGTKIAAVGAPSIIGLLPWVGS… |
| A0A838UCJ0 | 6-124 | EAKEFYKPRIGNAMAGLLIGTSILFWGVQFLISLTVVGEIGSEFIGIVGDGIFFLWLFLLRVNYFGKNSGKKVGLVIGATIIELIPF… |
| A0A0G1TXX5 | 6-107 | None |
| A0A1G2MQJ4 | 6-139 | None |
| A0A1G2L9Q6 | 28-165 | None |
| A0A0G1JCS5 | 3-113 | None |
| A0A2H0DXB2 | 1-148 | None |
| A0A0G1T8K4 | 2-118 | None |
| A0A1G2NXU7 | 10-121 | None |
| A0A1G2LC01 | 53-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.