DPCstruct | MC492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11176 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4H3M7 | 2-124 | GEKLTWFLGHIAEERTAPLSPQEFEDLIALYLQRFDEELAQIALKQSIGKHRANQHAARKDVITITLEKERNEYQSGGMELLNLCDP… |
| A0A286UKI0 | 12-161 | SRDGFYNSTSSWPLAKMEAAAEKRVKRASGSIDRYTFFFHAIPPESEKNALSLDELHDLVGNVWLARHDTALEEERKNRRKGRPKST… |
| R9P352 | 96-258 | None |
| K7FCW8 | 42-219 | None |
| A0A182TPG3 | 382-534 | None |
| A0A1R0GVB1 | 18-213 | None |
| A0A817KQI3 | 186-352 | None |
| A0A507EX23 | 314-464 | None |
| A0A7F8QKY1 | 7-112 | None |
| A0A818DIP5 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.