DPCstruct | MC49194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4SAN0 | 234-316 | VCTNPVDRKVEEELRKLFEVRPVWSRNAVKANISVHPDKLKLLLPCLAYYMITGPWRSLWVRFGYDPRKHPEAKIYQVLDFRI |
| M7ZKQ6 | 1-73 | MAVCKLFDERPVWPRQSLYERLIDDGVHVSTSQFKSLLFKAGYYFSTGPFGKFWIKKEYDPRKDPESRICKYQ |
| A0A2G9RU65 | 2-64 | None |
| U6KJP6 | 651-714 | None |
| H0EJ18 | 1-64 | None |
| A0A6A2XMN2 | 1-69 | None |
| A0A4X2KUS8 | 228-307 | None |
| A0A0D2WW78 | 420-492 | None |
| A0A4X2L1D6 | 231-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.