DPCstruct | MC4919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5Z2Z7 | 5-153 | QKFIDFMIPENDELINYSHRTKTERIADIIMNEGFEFVDSLQKTTDTVSKDPVHLQYWHNLREIYGNFTVVLSISKALMDKYIVKLN… |
| R6AMA6 | 1-141 | MQDLFKKLFDFNDYRYFYHITGHGVGESIIENGLLMAEKEYYTTMVEITPDMITDPEKFLTDEKGFGAMERDEMVLIRVPKSMGYDF… |
| A0A7X9JTV0 | 2-126 | None |
| A0A3D5X4G5 | 2-140 | None |
| A0A7V4JMM5 | 75-215 | None |
| R5MSY5 | 94-220 | None |
| A0A1Q6K4G7 | 129-278 | None |
| A0A3D2MF62 | 407-568 | None |
| A0A7Y7QK71 | 38-179 | None |
| R6SP54 | 6-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.