DPCstruct | MC49188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.94 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | CL0361- PF10453 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WUP5 | 1-117 | MGFEAEDRDYYKPVEVCCDIAFYTEEEYRKHLDGHIECPVEGCSFTAHQKAMRIHKEVVHDSGLFDTIYRQTCDKSVQIWRESRKRN… |
| A0A1S3DT44 | 2-103 | FDADAFSCETCCRGFPTQEQLDTHLGQHVTCGIDGCTLSAHPGILEVHVRFQHRTGLFKEINNAEVDKWIQDRKNRFPTLKTIEAKE… |
| A0A5C6N959 | 95-215 | None |
| A0A6H5I8E6 | 195-306 | None |
| A0A4W3IJ05 | 19-137 | None |
| A0A1I8GX92 | 13-132 | None |
| A0A3P9JRC2 | 12-142 | None |
| H2NJS8 | 159-276 | None |
| L1JT01 | 25-147 | None |
| A0A1S4EWL4 | 96-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.