DPCstruct | MC49187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 6.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 64.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WU72 | 1-103 | MITDLNTFLRKAVPDTKLTIKKYLDVKFEYLSYCLKVKEMDDEEYGFAMVQEPLYRVETGNYEYRLVLRCRQDARTRFAKMRNDVLV… |
| A0A1B6CIQ1 | 4-114 | FGIETLRAIKPILTDLGTYLNKAIPDTKLTIRKYADTKFEYLSYCLQVKEKDDEEYSYSAQQEPLYRVETGNYEYRLILRCRQDARN… |
| A0A1I8HD92 | 83-172 | None |
| A0A498M7Q3 | 222-330 | None |
| A0A183T5G2 | 73-173 | None |
| A0A814DV57 | 418-526 | None |
| A0A6V7UZW2 | 214-320 | None |
| Q8C1W2 | 220-333 | None |
| A0A3P7P1U7 | 2-104 | None |
| A0A817UK01 | 223-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.