DPCstruct | MC49175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RMQ2 | 65-132 | YSVSISGLVNKHIQLSMDDIRMLPKYNVTATLQCAGNKRTAMSKVRKVRGVGWDVSALGNATWGGAKL |
| A0A7G5J7V9 | 210-291 | LTADTHTVRIDGNVPSPLCLSIHQLQTEFPQHEVICALECAGNRRHAMRTLLKEVQGIDWGDAAIMNCKWKGPRLRDVLLRA |
| A0A7J6S034 | 252-338 | None |
| A0A094GNA5 | 14-97 | None |
| A0A2I0HPJ3 | 41-127 | None |
| A0A090VQ05 | 91-168 | None |
| F4Q1T4 | 56-135 | None |
| A0A0G4HQS2 | 119-205 | None |
| A0A2V6RPT7 | 502-580 | None |
| A0A7J6UCB1 | 110-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.