DPCstruct | MC4917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 287 ± 33 aa |
| Standard deviation of domain lengths | 33.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660Q5W6 | 252-519 | PPSVNRLLQNNPAAAVLLDFIRRNVLEHRYKLQPDIMRQVEEICGPLDWRLPYAHSAYWGYRGAAQAQGFEKLACERMVYQSAAAAF… |
| A0A7X9B4A2 | 22-302 | EATLRRRWMTMKYRLLPDWLKKLNAKYGNLDWRLAEAHAIYWAERGREKWTEDKDTFKRLSCDRMIFQSPAAAFETGRLVYLKDIQH… |
| A0A3D3UZE4 | 167-463 | None |
| A0A7X6UT38 | 55-325 | None |
| A0A7X7G4F9 | 194-446 | None |
| A0A3D3JXQ8 | 2-247 | None |
| A0A6I1K257 | 202-495 | None |
| A0A2E7QLS2 | 551-834 | None |
| A0A1W6LJW2 | 260-581 | None |
| A0A1V6G7W2 | 241-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.