DPCstruct | MC49166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 193 ± 48 aa |
| Standard deviation of domain lengths | 48.04 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352KUP4 | 334-467 | VARELNQILQKYAQVRTSAKMLREDQVYGDLNPNLDEVAMPDRYQPHRLITNRQGFRNINSLLLGSSRQRILAIGDSFTYGLHIDNH… |
| A0A855A4E6 | 88-339 | EPYLNEGIVMYGKMALEAFYDCQEQAADYAEVISTIKRAVPSAEVYNIVVPTHVEFALPEKYKADFSVSERPTLDAVYNNYSAEVKG… |
| A0A5C5Z7F0 | 7-194 | None |
| A0A537TAQ4 | 6-193 | None |
| A0A259LXQ3 | 217-448 | None |
| A0A1V1NUZ6 | 1-132 | None |
| A0A420WGW2 | 53-311 | None |
| A0A7X7DF61 | 9-205 | None |
| A0A109CD77 | 2-179 | None |
| A0A1G1J1R3 | 13-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.